"componentId" : "kudos.widget.button", "actions" : [ var keycodes = { "selector" : "#messageview_0", // We made it! "actions" : [ "actions" : [ } { { }, // console.log('watching: ' + key); ] }); if ( count == neededkeys.length ) { }, $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); } { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", }, notifCount = parseInt($(this).html()) + notifCount; }, "eventActions" : [ { "event" : "approveMessage", }); ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE, Diesen Thema für aktuellen Benutzer floaten, Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_6f0de568f0e8b2_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/ArchivFestnetz-und-LTE-Geraete/thread-id/11780&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }, var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "actions" : [ event.preventDefault(); "event" : "editProductMessage", "message" : "1407128", } "event" : "ProductMessageEdit", { "event" : "unapproveMessage", "event" : "addMessageUserEmailSubscription", "event" : "removeThreadUserEmailSubscription", "truncateBodyRetainsHtml" : "false", }, } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "parameters" : { ] { } { { "action" : "rerender" Notebook, Smartphone) kann nicht hergestellt werden. "context" : "", "useSimpleView" : "false", "context" : "", "useCountToKudo" : "false", } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "eventActions" : [ "includeRepliesModerationState" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ ] "message" : "1408164", "action" : "rerender" { })(LITHIUM.jQuery); // Pull in global jQuery reference ] } { "action" : "rerender" "event" : "expandMessage", { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1392048,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" ] "actions" : [ ] { "defaultAriaLabel" : "", ] "action" : "rerender" { } }, "}); "context" : "envParam:quiltName,message", } }, "context" : "", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } .attr('aria-selected','true'); "action" : "rerender" { "event" : "ProductAnswerComment", } "context" : "envParam:selectedMessage", } else { { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { ] \\n\\t\\t\\t\\n\\t\\n\\n\\t\\n\\n\\t\\t\";LITHIUM.AjaxSupport.defaultAjaxErrorHtml = \", \\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\t\\t, '; { "actions" : [ ] "context" : "", }, event.stopPropagation(); "actions" : [ ] { "action" : "rerender" ', 'ajax'); "useCountToKudo" : "false", { ], { "event" : "QuickReply", $(this).removeAttr('href'); { "initiatorBinding" : true, "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", "action" : "rerender" { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "context" : "", } }, "selector" : "#kudosButtonV2_0", "displaySubject" : "true", "action" : "rerender" "event" : "MessagesWidgetAnswerForm", "event" : "kudoEntity", ] "actions" : [ "action" : "rerender" "showCountOnly" : "false", "event" : "ProductAnswerComment", })(LITHIUM.jQuery); { $('#vodafone-community-header .lia-search-input-wrapper').hide(); }, "context" : "lia-deleted-state", }); "actions" : [ { return; "parameters" : { "action" : "rerender" { ] "context" : "", }, { }, "event" : "MessagesWidgetMessageEdit", "action" : "rerender" "message" : "207240", })(LITHIUM.jQuery); '; }, "useSimpleView" : "false", "}); "context" : "", "context" : "", { } "context" : "envParam:quiltName", "showCountOnly" : "false", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1408164,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "truncateBodyRetainsHtml" : "false", } "event" : "ProductAnswerComment", ] } ] ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivKIP/thread-id/48328","ajaxErrorEventName":"LITHIUM:ajaxError","token":"t68kxMZhZpK-mn7n4NHdWkE3hTc-pwW60kNwOvRlI_U. }, { LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "event" : "MessagesWidgetEditCommentForm", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":527,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFUBAVFbBF0GAxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVcV1VSAlxXBRRXWwYGSQEBDAVIV1EJC08DAFMEUVJUXVJSCFZAThUPVn1bVgB\/AhsIQCNFB11aQnksZkQVEAkBZQFGR2IANEMDS0tAWBU3cH9xcTEWD10SJDB4KRVeUUEWVwFcQUI1fyFndhRGCkYPWhwLBgpbFX99fyxiRgYQHx8="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "kudosLinksDisabled" : "false", $('#community-menu-toggle').click(function() { "actions" : [ "context" : "", { ] // Oops, not the right sequence, lets restart from the top. "action" : "pulsate" ] { "action" : "rerender" "action" : "rerender" } var cookieDomain = 'forum.vodafone.de'; }, "showCountOnly" : "false", "action" : "rerender" "action" : "rerender" } $('#node-menu li.has-sub>a').on('click', function(){ } } "context" : "envParam:feedbackData", "action" : "addClassName" "}); ] if ( watching ) { "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", } } ], { ], "event" : "deleteMessage", "includeRepliesModerationState" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $('#vodafone-community-header .lia-search-input-wrapper').hide(); You’ll want to make sure that your router is set to an open NAT type or NAT type 1 on PS4. } "actions" : [ "actions" : [ "defaultAriaLabel" : "", "quiltName" : "ForumMessage", ] Zeigt, welche Beiträge Ihr cool findet – klickt auf „Gefällt mir“! setCookie: function(cookieName, cookieValue) { "event" : "ProductAnswer", { { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { logmein: [76, 79, 71, 77, 69, 73, 78], } }, { ] "truncateBody" : "true", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1392048 .lia-rating-control-passive', '#form_1'); "parameters" : { "truncateBody" : "true", $(document).keydown(function(e) { LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); { "truncateBodyRetainsHtml" : "false", LITHIUM.AjaxSupport.useTickets = false; } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ { "componentId" : "forums.widget.message-view", "action" : "rerender" "defaultAriaLabel" : "", { { var count = 0; { { // just for convenience, you need a login anyways... }, "selector" : "#kudosButtonV2_3", } LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { }, }, }, "actions" : [ }, { .attr('aria-expanded','true'); })(LITHIUM.jQuery); window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":527,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFUBAVFbBF0GAxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVcV1VSAlxXBRRXWwYGSQEBDAVIV1EJC08DAFMEUVJUXVJSCFZAThUPVn1bVgB\/AhsIQCNFB11aQnksZkQVEAkBZQFGR2IANEMDS0tAWBU3cH9xcTEWD10SJDB4KRVeUUEWVwFcQUI1fyFndhRGCkYPWhwLBgpbFX99fyxiRgYQHx8="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "", "actions" : [ "context" : "envParam:quiltName", }, }, return; "context" : "", "actions" : [ //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} ], "event" : "AcceptSolutionAction", $('#custom-overall-notif-count').html(notifCount); Worldwide shipping! }, "event" : "markAsSpamWithoutRedirect", { { "revokeMode" : "true", } { // Register the click event handler "action" : "pulsate" LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "}); ] } .attr('aria-expanded','false'); "kudosable" : "true", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); "useSimpleView" : "false", "actions" : [ ] "showCountOnly" : "false", "action" : "rerender" ] }, } "action" : "rerender" "context" : "envParam:entity", }, count++; "context" : "", "kudosable" : "true", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); return; "actions" : [ "event" : "ProductAnswerComment", "initiatorBinding" : true, { if ( watching ) { "action" : "addClassName" resetMenu(); "kudosLinksDisabled" : "false", { ;(function($){ "event" : "MessagesWidgetMessageEdit", { //} else { ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "actions" : [ { } "context" : "", //if(height > 430) { } LITHIUM.AjaxSupport.ComponentEvents.set({ }); ] { "linkDisabled" : "false" }, ] { watching = false; "action" : "pulsate" { } "actions" : [ ] { }, $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); } $(this).toggleClass('active'); "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1408164,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "initiatorDataMatcher" : "data-lia-message-uid" }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivKIP/thread-id/48328","ajaxErrorEventName":"LITHIUM:ajaxError","token":"4FwR714ARfrp_RqZhF_M9cIcI82hSbUYiIMWHc64jl8. "actions" : [ "event" : "QuickReply", if ( key == neededkeys[0] ) { "parameters" : { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); { "actions" : [ "event" : "MessagesWidgetEditAction", { { var keycodes = { "actions" : [ "context" : "", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/48328","ajaxErrorEventName":"LITHIUM:ajaxError","token":"HAOVNVON-mDG5wqcd3WU52mxK2JNaOr4ISyQaXaJUxo. { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); ] "actions" : [ { { "action" : "pulsate" { "event" : "removeMessageUserEmailSubscription", { LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "pulsate" "action" : "rerender" "truncateBody" : "true", "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "componentId" : "kudos.widget.button", { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); ] "context" : "envParam:selectedMessage", ], { { "action" : "pulsate" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "includeRepliesModerationState" : "false", { "displayStyle" : "horizontal", "context" : "", "action" : "rerender" "action" : "pulsate" LITHIUM.Auth.CHECK_SESSION_TOKEN = '4CSwEq9KfT4poSrmG8vSbpCGxIsQ4qNHU9OHk-AeGiE. "actions" : [ }, } "initiatorDataMatcher" : "data-lia-message-uid" { ctaHTML += "Lösung noch nicht gefunden? "event" : "removeMessageUserEmailSubscription", "action" : "rerender" } "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" Execute whatever should happen when entering the right sequence } $(event.data.selector).addClass('cssmenu-open') count = 0; "componentId" : "forums.widget.message-view", })(LITHIUM.jQuery); { "context" : "envParam:quiltName", "event" : "approveMessage", { { { .attr('aria-expanded','true') "actions" : [ "action" : "pulsate" // We're good so far. { { })(LITHIUM.jQuery); .attr('aria-expanded','false'); } "actions" : [ "action" : "rerender" "action" : "pulsate" }; }, "context" : "", "event" : "MessagesWidgetEditCommentForm", { ] window.onclick = function(event) { } } } } "messageViewOptions" : "1111110111111111111110111110100101001101" { { $(document).ready(function(){ } $(document).ready(function(){ "action" : "rerender" }, { { "context" : "", { { }, "displayStyle" : "horizontal", } "message" : "207184", ] LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); { { }, lithstudio: [], "event" : "MessagesWidgetEditAnswerForm", { ', 'ajax'); }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "context" : "", "event" : "kudoEntity", "actions" : [ LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; ] } "; LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-207184 .lia-rating-control-passive', '#form'); "}); ] { } { })(LITHIUM.jQuery); "context" : "", "action" : "rerender" { "context" : "envParam:quiltName,message", $(this).toggleClass('active'); LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'BLXyjzdvUdCRk41SlFfydqFJZbon1Zc5YWZ4ZFdYZOc. { } element.children('ul').slideDown(); { })(LITHIUM.jQuery); "useCountToKudo" : "false",